SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wszc_ (5wsz C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (52 species)
    not a true protein
  7. 2286944Species Bacillus thuringiensis [TaxId:29339] [330245] (1 PDB entry)
  8. 2286997Domain d5wszc_: 5wsz C: [330298]
    automated match to d4gboa_
    complexed with cu

Details for d5wszc_

PDB Entry: 5wsz (more details), 2.57 Å

PDB Description: crystal structure of a lytic polysaccharide monooxygenase,btlpmo10a, from bacillus thuringiensis
PDB Compounds: (C:) LpmO10A

SCOPe Domain Sequences for d5wszc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wszc_ b.1.18.0 (C:) automated matches {Bacillus thuringiensis [TaxId: 29339]}
hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln

SCOPe Domain Coordinates for d5wszc_:

Click to download the PDB-style file with coordinates for d5wszc_.
(The format of our PDB-style files is described here.)

Timeline for d5wszc_:

  • d5wszc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23