Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries) |
Domain d5m7ef2: 5m7e F:77-378 [330296] Other proteins in same PDB: d5m7ea1, d5m7ea2, d5m7eb1, d5m7eb2, d5m7ec1, d5m7ec2, d5m7ed1, d5m7ed2, d5m7ee_, d5m7ef1, d5m7ef3 automated match to d3tiia2 complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5 |
PDB Entry: 5m7e (more details), 2.05 Å
SCOPe Domain Sequences for d5m7ef2:
Sequence, based on SEQRES records: (download)
>d5m7ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5m7ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaayngnvwiakssagilisseasell dfvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsadktch ltnhciqkygryeegnemffeefnqylmdalnttlensillqikhiirsclmciepaist khlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplats ifikl
Timeline for d5m7ef2: