SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m7ef2 (5m7e F:77-378)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195211Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2195212Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2195213Species Chicken (Gallus gallus) [TaxId:9031] [311385] (29 PDB entries)
  8. 2286995Domain d5m7ef2: 5m7e F:77-378 [330296]
    Other proteins in same PDB: d5m7ea1, d5m7ea2, d5m7eb1, d5m7eb2, d5m7ec1, d5m7ec2, d5m7ed1, d5m7ed2, d5m7ee_, d5m7ef1, d5m7ef3
    automated match to d3tiia2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5

Details for d5m7ef2

PDB Entry: 5m7e (more details), 2.05 Å

PDB Description: tubulin-bkm120 complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5m7ef2:

Sequence, based on SEQRES records: (download)

>d5m7ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5m7ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaayngnvwiakssagilisseasell
dfvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsadktch
ltnhciqkygryeegnemffeefnqylmdalnttlensillqikhiirsclmciepaist
khlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplats
ifikl

SCOPe Domain Coordinates for d5m7ef2:

Click to download the PDB-style file with coordinates for d5m7ef2.
(The format of our PDB-style files is described here.)

Timeline for d5m7ef2:

  • d5m7ef2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23