Lineage for d1byed2 (1bye D:1-80)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181182Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 181188Domain d1byed2: 1bye D:1-80 [33029]
    Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1

Details for d1byed2

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byed2 c.47.1.5 (D:1-80) Glutathione S-transferase {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOP Domain Coordinates for d1byed2:

Click to download the PDB-style file with coordinates for d1byed2.
(The format of our PDB-style files is described here.)

Timeline for d1byed2: