SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uswa1 (5usw A:1-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2286941Species Vibrio fischeri [TaxId:312309] [330242] (1 PDB entry)
  8. 2286983Domain d5uswa1: 5usw A:1-278 [330284]
    Other proteins in same PDB: d5uswa2, d5uswb2, d5uswc2, d5uswd2
    automated match to d1aj2a_
    complexed with act, fmt, gol

Details for d5uswa1

PDB Entry: 5usw (more details), 1.64 Å

PDB Description: the crystal structure of 7,8-dihydropteroate synthase from vibrio fischeri es114
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d5uswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uswa1 c.1.21.1 (A:1-278) automated matches {Vibrio fischeri [TaxId: 312309]}
mklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidigge
strpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvral
qepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakd
klildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgsl
acatiaamkgaqiirvhdfeqtmdivkvcqatleqsph

SCOPe Domain Coordinates for d5uswa1:

Click to download the PDB-style file with coordinates for d5uswa1.
(The format of our PDB-style files is described here.)

Timeline for d5uswa1:

  • d5uswa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23