SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5upqa1 (5upq A:2-513)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (21 species)
    not a true protein
  7. 2222723Species Streptomyces platensis [TaxId:684832] [278375] (3 PDB entries)
  8. 2286979Domain d5upqa1: 5upq A:2-513 [330280]
    Other proteins in same PDB: d5upqa2
    automated match to d3vnra_
    complexed with 8jj, cl, gol, so4

Details for d5upqa1

PDB Entry: 5upq (more details), 2.42 Å

PDB Description: acyl-coa synthetase ptmm4 from streptomyces platensis in complex with sbnp465 ligand
PDB Compounds: (A:) Acyl-CoA synthetase PtmA2

SCOPe Domain Sequences for d5upqa1:

Sequence, based on SEQRES records: (download)

>d5upqa1 e.23.1.0 (A:2-513) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytaamsgrqcgs
llshtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvva
eevrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrft
rsgaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageic
argtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksaaenifpa
evencieqhpavreaavigvpntrwaqdvkavvvlepdagvseqeiidhcrpriasykkp
ksvafaaalprtvsgardydaldkeyggggyp

Sequence, based on observed residues (ATOM records): (download)

>d5upqa1 e.23.1.0 (A:2-513) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytasgrqcgsll
shtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvvaee
vrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrftrs
gaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageicar
gtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksaaenifpaev
encieqhpavreaavigvpntrwaqdvkavvvlepdagvseqeiidhcrpriasykkpks
vafaaalprtvsgardydaldkeyggggyp

SCOPe Domain Coordinates for d5upqa1:

Click to download the PDB-style file with coordinates for d5upqa1.
(The format of our PDB-style files is described here.)

Timeline for d5upqa1:

  • d5upqa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5upqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5upqb_