SCOP 1.69: Domain d1byec2: 1bye C:1-80

Lineage for d1byec2 (1bye C:1-80)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class phi GST [81367] (3 species)

7. Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)

8. Domain d1byec2: 1bye C:1-80 [33028]
   Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1

Details for d1byec2

PDB Entry: 1bye, 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byec2:

Sequence; same for both SEQRES and ATOM records:

>d1byec2 c.47.1.5 (C:1-80) Class phi GST {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

Timeline for d1byec2:

• d1byec2 first appeared (with stable ids) in SCOP 1.55
  
• d1byec2 appears in SCOP 1.67
  
• d1byec2 appears in SCOP 1.71
  
• d1byec2 appears in the current release, SCOPe 2.08