SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufjb_ (5ufj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (237 PDB entries)
    Uniprot P68871
  8. 2286978Domain d5ufjb_: 5ufj B: [330279]
    Other proteins in same PDB: d5ufja_, d5ufjc_
    automated match to d2hbsb_
    complexed with 86m, cmo, hem

Details for d5ufjb_

PDB Entry: 5ufj (more details), 2.05 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin s (liganded sickle cell hemoglobin) complexed with gbt compound 6
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5ufjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufjb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d5ufjb_:

Click to download the PDB-style file with coordinates for d5ufjb_.
(The format of our PDB-style files is described here.)

Timeline for d5ufjb_:

  • d5ufjb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23