Lineage for d5ugla_ (5ugl A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (646 PDB entries)
  8. 2286976Domain d5ugla_: 5ugl A: [330277]
    automated match to d4v04b_
    complexed with anp, so4; mutant

Details for d5ugla_

PDB Entry: 5ugl (more details), 1.86 Å

PDB Description: crystal structure of fgf receptor 2 tyrosine kinase domain harboring the d650v activating mutation
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d5ugla_:

Sequence, based on SEQRES records: (download)

>d5ugla_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmeys
ydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfgl
arvinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgi
pveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d5ugla_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrvpeeqmt
fkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglarvinnidyykk
ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d5ugla_:

Click to download the PDB-style file with coordinates for d5ugla_.
(The format of our PDB-style files is described here.)

Timeline for d5ugla_:

  • d5ugla_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23