SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tuya_ (5tuy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (1 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (17 PDB entries)
  8. 2286972Domain d5tuya_: 5tuy A: [330273]
    automated match to d4nvqb_
    complexed with 7l6, sam, zn

Details for d5tuya_

PDB Entry: 5tuy (more details), 2.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor ms0124
PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5tuya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuya_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqs

SCOPe Domain Coordinates for d5tuya_:

Click to download the PDB-style file with coordinates for d5tuya_.
(The format of our PDB-style files is described here.)

Timeline for d5tuya_:

  • d5tuya_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23