Lineage for d5uoja_ (5uoj A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197409Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2197597Species Mouse (Mus musculus) [TaxId:10090] [56131] (25 PDB entries)
  8. 2286969Domain d5uoja_: 5uoj A: [330270]
    automated match to d1bmka_

Details for d5uoja_

PDB Entry: 5uoj (more details), 2.1 Å

PDB Description: the structure of the map kinase p38 at 2.1 angstroms resolution
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d5uoja_:

Sequence, based on SEQRES records: (download)

>d5uoja_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl

Sequence, based on observed residues (ATOM records): (download)

>d5uoja_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglamtgyvatrwyra
peimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkki
ssesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaq
yhdpddepvadpydqsfesrdllidewksltydevisfvpppl

SCOPe Domain Coordinates for d5uoja_:

Click to download the PDB-style file with coordinates for d5uoja_.
(The format of our PDB-style files is described here.)

Timeline for d5uoja_:

  • d5uoja_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23