Lineage for d1byeb2 (1bye B:1-80)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123482Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 123486Domain d1byeb2: 1bye B:1-80 [33027]
    Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1

Details for d1byeb2

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byeb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOP Domain Coordinates for d1byeb2:

Click to download the PDB-style file with coordinates for d1byeb2.
(The format of our PDB-style files is described here.)

Timeline for d1byeb2: