Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries) |
Domain d1byeb2: 1bye B:1-80 [33027] Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1 |
PDB Entry: 1bye (more details), 2.8 Å
SCOP Domain Sequences for d1byeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byeb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Maize (Zea mays), type I} apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg dlylfesraickyaarknkp
Timeline for d1byeb2: