SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x1xa_ (5x1x A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189565Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2189566Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2189861Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2189862Protein automated matches [191036] (15 species)
    not a true protein
  7. 2286964Species Staphylococcus aureus [TaxId:548470] [330265] (1 PDB entry)
  8. 2286965Domain d5x1xa_: 5x1x A: [330266]
    automated match to d4v14a_

Details for d5x1xa_

PDB Entry: 5x1x (more details)

PDB Description: solution nmr structure of dna mismatch repair protein mutt (family nudix hydrolase) from methicillin resistant staphylococcus aureus 252
PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d5x1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1xa_ d.113.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 548470]}
mkkvinvvgaiifsdnkilcaqrsekmslplmwefpggkveknetekdalireireemkc
dlivgdkvitteheydfgivrlttykctlnkelptltehksiewlsineldklnwapadi
pavnkimteg

SCOPe Domain Coordinates for d5x1xa_:

Click to download the PDB-style file with coordinates for d5x1xa_.
(The format of our PDB-style files is described here.)

Timeline for d5x1xa_:

  • d5x1xa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23