SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m7gc2 (5m7g C:246-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (30 PDB entries)
  8. 2286953Domain d5m7gc2: 5m7g C:246-440 [330254]
    Other proteins in same PDB: d5m7ga1, d5m7gb1, d5m7gc1, d5m7gd1, d5m7ge_, d5m7gf1, d5m7gf2, d5m7gf3
    automated match to d4i50a2
    complexed with acp, ca, fb7, gdp, gol, gtp, mes, mg

Details for d5m7gc2

PDB Entry: 5m7g (more details), 2.25 Å

PDB Description: tubulin-mtd147 complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5m7gc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7gc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5m7gc2:

Click to download the PDB-style file with coordinates for d5m7gc2.
(The format of our PDB-style files is described here.)

Timeline for d5m7gc2:

  • d5m7gc2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23