Lineage for d5tzcd_ (5tzc D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2286950Domain d5tzcd_: 5tzc D: [330251]
    Other proteins in same PDB: d5tzca2, d5tzcb2, d5tzcc2
    automated match to d4d09a_
    complexed with 7oj, mg, zn

Details for d5tzcd_

PDB Entry: 5tzc (more details), 2.36 Å

PDB Description: crystal structure of human pde2a in complex with (5s)-1-[(3-bromo-4- fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2,4]triazolo[1,5- a]pyrimidin-7-yl}piperidine
PDB Compounds: (D:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tzcd_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlar
fclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhr
gtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlm
rdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrk
iaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka
aelyervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d5tzcd_:

Click to download the PDB-style file with coordinates for d5tzcd_.
(The format of our PDB-style files is described here.)

Timeline for d5tzcd_:

  • d5tzcd_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23