Lineage for d1axdb2 (1axd B:1-80)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71086Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 71088Domain d1axdb2: 1axd B:1-80 [33025]
    Other proteins in same PDB: d1axda1, d1axdb1

Details for d1axdb2

PDB Entry: 1axd (more details), 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione

SCOP Domain Sequences for d1axdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axdb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOP Domain Coordinates for d1axdb2:

Click to download the PDB-style file with coordinates for d1axdb2.
(The format of our PDB-style files is described here.)

Timeline for d1axdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axdb1