SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5upua_ (5upu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080817Species Mycobacterium tuberculosis [TaxId:83332] [274113] (7 PDB entries)
  8. 2286948Domain d5upua_: 5upu A: [330249]
    automated match to d4zqrc_
    complexed with 6q9, imp

Details for d5upua_

PDB Entry: 5upu (more details), 2.91 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the presence of tbk6
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5upua_:

Sequence, based on SEQRES records: (download)

>d5upua_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamrgrggatsyskdryfaddalse
dklvpegiegrvpfrgplssvihqltgglraamgytgsptievlqqaqfvritpagl

Sequence, based on observed residues (ATOM records): (download)

>d5upua_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamvpegiegrvpfrgplssvihql
tgglraamgytgsptievlqqaqfvritpagl

SCOPe Domain Coordinates for d5upua_:

Click to download the PDB-style file with coordinates for d5upua_.
(The format of our PDB-style files is described here.)

Timeline for d5upua_:

  • d5upua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23