Lineage for d5upua_ (5upu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080817Species Mycobacterium tuberculosis [TaxId:83332] [274113] (7 PDB entries)
  8. 2286948Domain d5upua_: 5upu A: [330249]
    automated match to d4zqrc_
    complexed with 6q9, imp

Details for d5upua_

PDB Entry: 5upu (more details), 2.91 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the presence of tbk6
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5upua_:

Sequence, based on SEQRES records: (download)

>d5upua_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamrgrggatsyskdryfaddalse
dklvpegiegrvpfrgplssvihqltgglraamgytgsptievlqqaqfvritpagl

Sequence, based on observed residues (ATOM records): (download)

>d5upua_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamvpegiegrvpfrgplssvihql
tgglraamgytgsptievlqqaqfvritpagl

SCOPe Domain Coordinates for d5upua_:

Click to download the PDB-style file with coordinates for d5upua_.
(The format of our PDB-style files is described here.)

Timeline for d5upua_:

  • d5upua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23