SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wszb_ (5wsz B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (50 species)
    not a true protein
  7. 2286944Species Bacillus thuringiensis [TaxId:29339] [330245] (1 PDB entry)
  8. 2286945Domain d5wszb_: 5wsz B: [330246]
    automated match to d4gboa_
    complexed with cu

Details for d5wszb_

PDB Entry: 5wsz (more details), 2.57 Å

PDB Description: crystal structure of a lytic polysaccharide monooxygenase,btlpmo10a, from bacillus thuringiensis
PDB Compounds: (B:) LpmO10A

SCOPe Domain Sequences for d5wszb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wszb_ b.1.18.0 (B:) automated matches {Bacillus thuringiensis [TaxId: 29339]}
hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln

SCOPe Domain Coordinates for d5wszb_:

Click to download the PDB-style file with coordinates for d5wszb_.
(The format of our PDB-style files is described here.)

Timeline for d5wszb_:

  • d5wszb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23