Lineage for d5uswb1 (5usw B:1-277)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2286941Species Vibrio fischeri [TaxId:312309] [330242] (1 PDB entry)
  8. 2286942Domain d5uswb1: 5usw B:1-277 [330243]
    Other proteins in same PDB: d5uswa2, d5uswb2, d5uswc2, d5uswd2
    automated match to d1aj2a_
    complexed with act, fmt, gol

Details for d5uswb1

PDB Entry: 5usw (more details), 1.64 Å

PDB Description: the crystal structure of 7,8-dihydropteroate synthase from vibrio fischeri es114
PDB Compounds: (B:) dihydropteroate synthase

SCOPe Domain Sequences for d5uswb1:

Sequence, based on SEQRES records: (download)

>d5uswb1 c.1.21.1 (B:1-277) automated matches {Vibrio fischeri [TaxId: 312309]}
mklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidigge
strpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvral
qepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakd
klildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgsl
acatiaamkgaqiirvhdfeqtmdivkvcqatleqsp

Sequence, based on observed residues (ATOM records): (download)

>d5uswb1 c.1.21.1 (B:1-277) automated matches {Vibrio fischeri [TaxId: 312309]}
mklisknksllldrshvmgilnvtpdthldaalkqaekmvkagvsfidiggestrpgape
vslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvralqepnalkv
aaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakdklildpgf
gfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgslacatiaam
kgaqiirvhdfeqtmdivkvcqatleqsp

SCOPe Domain Coordinates for d5uswb1:

Click to download the PDB-style file with coordinates for d5uswb1.
(The format of our PDB-style files is described here.)

Timeline for d5uswb1:

  • d5uswb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23