SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tp3b_ (5tp3 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (114 PDB entries)
  8. 2286939Domain d5tp3b_: 5tp3 B: [330240]
    automated match to d4grwe_

Details for d5tp3b_

PDB Entry: 5tp3 (more details), 1.87 Å

PDB Description: crystal structure of the rsv-neutralizing single-domain antibody f- vhh-4
PDB Compounds: (B:) f-vhh-4

SCOPe Domain Sequences for d5tp3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tp3b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftldyyyigwfrqapgkereavscisgssgstyy
pdsvkgrftisrdnakntvylqmnslkpedtavyycatirssswggcvhygmdywgkgtq
vtvss

SCOPe Domain Coordinates for d5tp3b_:

Click to download the PDB-style file with coordinates for d5tp3b_.
(The format of our PDB-style files is described here.)

Timeline for d5tp3b_:

  • d5tp3b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from other chains:
(mouse over for more information)
d5tp3a_