Lineage for d1axda2 (1axd A:1-80)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315650Protein Class phi GST [81367] (3 species)
  7. 315651Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 315652Domain d1axda2: 1axd A:1-80 [33024]
    Other proteins in same PDB: d1axda1, d1axdb1

Details for d1axda2

PDB Entry: 1axd (more details), 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione

SCOP Domain Sequences for d1axda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOP Domain Coordinates for d1axda2:

Click to download the PDB-style file with coordinates for d1axda2.
(The format of our PDB-style files is described here.)

Timeline for d1axda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axda1