SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wvua_ (5wvu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (16 species)
    not a true protein
  7. 2184845Species Thermus thermophilus HB8 [TaxId:300852] [188073] (2 PDB entries)
  8. 2286937Domain d5wvua_: 5wvu A: [330238]
    automated match to d1wgza_
    complexed with gol, zn

Details for d5wvua_

PDB Entry: 5wvu (more details), 2.6 Å

PDB Description: crystal structure of carboxypeptidase from thermus thermophilus
PDB Compounds: (A:) Thermostable carboxypeptidase 1

SCOPe Domain Sequences for d5wvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvua_ d.92.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaalyg

SCOPe Domain Coordinates for d5wvua_:

Click to download the PDB-style file with coordinates for d5wvua_.
(The format of our PDB-style files is described here.)

Timeline for d5wvua_:

  • d5wvua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23