Lineage for d1bx9a2 (1bx9 A:1-85)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123518Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)
  8. 123521Domain d1bx9a2: 1bx9 A:1-85 [33023]
    Other proteins in same PDB: d1bx9a1

Details for d1bx9a2

PDB Entry: 1bx9 (more details), 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide

SCOP Domain Sequences for d1bx9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx9a2 c.47.1.5 (A:1-85) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnll

SCOP Domain Coordinates for d1bx9a2:

Click to download the PDB-style file with coordinates for d1bx9a2.
(The format of our PDB-style files is described here.)

Timeline for d1bx9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx9a1