SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5upta1 (5upt A:2-513)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2222723Species Streptomyces platensis [TaxId:684832] [278375] (3 PDB entries)
  8. 2286926Domain d5upta1: 5upt A:2-513 [330227]
    Other proteins in same PDB: d5upta2
    automated match to d3vnra_
    complexed with 8jg, cl, gol, so4

Details for d5upta1

PDB Entry: 5upt (more details), 1.92 Å

PDB Description: acyl-coa synthetase ptma2 from streptomyces platensis in complex with sbnp468 ligand
PDB Compounds: (A:) Acyl-CoA synthetase PtmA2

SCOPe Domain Sequences for d5upta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5upta1 e.23.1.0 (A:2-513) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytaamsgrqcgs
llshtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvva
eevrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrft
rsgaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageic
argtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksaaenifpa
evencieqhpavreaavigvpntrwaqdvkavvvlepdagvseqeiidhcrpriasykkp
ksvafaaalprtvsgardydaldkeyggggyp

SCOPe Domain Coordinates for d5upta1:

Click to download the PDB-style file with coordinates for d5upta1.
(The format of our PDB-style files is described here.)

Timeline for d5upta1:

  • d5upta1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5upta2