Lineage for d5upta1 (5upt A:2-513)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (23 species)
    not a true protein
  7. 2222723Species Streptomyces platensis [TaxId:684832] [278375] (3 PDB entries)
  8. 2286926Domain d5upta1: 5upt A:2-513 [330227]
    Other proteins in same PDB: d5upta2
    automated match to d3vnra_
    complexed with 8jg, cl, gol, so4

Details for d5upta1

PDB Entry: 5upt (more details), 1.92 Å

PDB Description: acyl-coa synthetase ptma2 from streptomyces platensis in complex with sbnp468 ligand
PDB Compounds: (A:) Acyl-CoA synthetase PtmA2

SCOPe Domain Sequences for d5upta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5upta1 e.23.1.0 (A:2-513) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytaamsgrqcgs
llshtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvva
eevrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrft
rsgaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageic
argtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksaaenifpa
evencieqhpavreaavigvpntrwaqdvkavvvlepdagvseqeiidhcrpriasykkp
ksvafaaalprtvsgardydaldkeyggggyp

SCOPe Domain Coordinates for d5upta1:

Click to download the PDB-style file with coordinates for d5upta1.
(The format of our PDB-style files is described here.)

Timeline for d5upta1:

  • d5upta1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5upta2