Lineage for d5upqb_ (5upq B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2222723Species Streptomyces platensis [TaxId:684832] [278375] (3 PDB entries)
  8. 2286925Domain d5upqb_: 5upq B: [330226]
    Other proteins in same PDB: d5upqa2
    automated match to d3vnra_
    complexed with 8jj, cl, gol, so4

Details for d5upqb_

PDB Entry: 5upq (more details), 2.42 Å

PDB Description: acyl-coa synthetase ptma2 from streptomyces platensis in complex with sbnp465 ligand
PDB Compounds: (B:) Acyl-CoA synthetase PtmA2

SCOPe Domain Sequences for d5upqb_:

Sequence, based on SEQRES records: (download)

>d5upqb_ e.23.1.0 (B:) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytaamsgrqcgs
llshtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvva
eevrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrft
rsgaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageic
argtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksaaenifpa
evencieqhpavreaavigvpntrwaqdvkavvvlepdagvseqeiidhcrpriasykkp
ksvafaaalprtvsgardydaldkeyggggyp

Sequence, based on observed residues (ATOM records): (download)

>d5upqb_ e.23.1.0 (B:) automated matches {Streptomyces platensis [TaxId: 684832]}
qhttigdvlrehrrshpgrtalvdgpvrltwpelddrvnrlagslaasgigrgdrimwlg
qnsfrvyeliaaagklgamvcvgywrwappemefalrdfdphlvvwqhqeihetvartre
algsddtarwlrhdsapqdpdgyeaflaaggladpdldidpdspvlvlytasgrqcgsll
shtnliamataaawlgdidhttaflnsgpmfhignhqfwgmptllmagknvivrrvvaee
vrdllvaeecthaflmpptvaeivrlnrdtghdlsrlratvaphlwegmattdtsrftrs
gaaagrgygqtelsgfavtaayggpaagnagrpgpgltvrvldtagrecavgeageicar
gtvvhrgywnrdevnahrfrsgwwhttdlgrrepdgsltflgtttrmlksfpaevencie
qhpavreaaviavvvlepdagvseqeiiriasykkpksvafaaalprtvsgardydaldk
eyggggyp

SCOPe Domain Coordinates for d5upqb_:

Click to download the PDB-style file with coordinates for d5upqb_.
(The format of our PDB-style files is described here.)

Timeline for d5upqb_:

  • d5upqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23