Lineage for d5umeb_ (5ume B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089931Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2089932Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 protein domains)
    automatically mapped to Pfam PF02219
  6. 2089958Protein automated matches [193645] (3 species)
    not a true protein
  7. 2286894Species Haemophilus influenzae [TaxId:71421] [330195] (1 PDB entry)
  8. 2286921Domain d5umeb_: 5ume B: [330222]
    Other proteins in same PDB: d5umee2
    automated match to d3fste_
    complexed with acy, edo, fad, fmt, so4

Details for d5umeb_

PDB Entry: 5ume (more details), 2.7 Å

PDB Description: crystal structure of 5,10-methylenetetrahydrofolate reductase metf from haemophilus influenzae
PDB Compounds: (B:) 5,10-Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d5umeb_:

Sequence, based on SEQRES records: (download)

>d5umeb_ c.1.23.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
kinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansgerdrthgivkaikqet
gleaaphltgidatpeelkqiardywdsgirrivalrgdepkgyakkpfyasdlvellrs
vadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqfffdienylrfrdrcasi
gidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldndpttrnlvaasvamdmv
kilsregvndfhfytlnrseltyaichmlgvrp

Sequence, based on observed residues (ATOM records): (download)

>d5umeb_ c.1.23.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
kinvsfeffppknekmetllwdsihrlkvlkpkfvsvtysgerdrthgivkaikqetgle
aaphltgidatpeelkqiardywdsgirrivalrgdpfyasdlvellrsvadfdisvaay
pevhpeaksaqadlinlkrkidaganhvitqfffdienylrfrdrcasigidteivpgil
pvtnfkqlqkmasftnvkipawlvkaydgldndpttrnlvaasvamdmvkilsregvndf
hfytlnrseltyaichmlgvrp

SCOPe Domain Coordinates for d5umeb_:

Click to download the PDB-style file with coordinates for d5umeb_.
(The format of our PDB-style files is described here.)

Timeline for d5umeb_:

  • d5umeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23