SCOP 1.69: Domain d1gnwb2: 1gnw B:2-85

Lineage for d1gnwb2 (1gnw B:2-85)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class phi GST [81367] (3 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)

8. Domain d1gnwb2: 1gnw B:2-85 [33022]
   Other proteins in same PDB: d1gnwa1, d1gnwb1

Details for d1gnwb2

PDB Entry: 1gnw, 2.2 Å

PDB Description: structure of glutathione s-transferase

SCOP Domain Sequences for d1gnwb2:

Sequence; same for both SEQRES and ATOM records:

>d1gnwb2 c.47.1.5 (B:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana)}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

Timeline for d1gnwb2:

• d1gnwb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gnwb2 appears in SCOP 1.67
  
• d1gnwb2 appears in SCOP 1.71
  
• d1gnwb2 appears in the current release, SCOPe 2.08