Lineage for d1gnwb2 (1gnw B:2-85)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181218Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)
  8. 181220Domain d1gnwb2: 1gnw B:2-85 [33022]
    Other proteins in same PDB: d1gnwa1, d1gnwb1

Details for d1gnwb2

PDB Entry: 1gnw (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase

SCOP Domain Sequences for d1gnwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnwb2 c.47.1.5 (B:2-85) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

SCOP Domain Coordinates for d1gnwb2:

Click to download the PDB-style file with coordinates for d1gnwb2.
(The format of our PDB-style files is described here.)

Timeline for d1gnwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnwb1