SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5umec_ (5ume C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089931Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2089932Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 protein domains)
    automatically mapped to Pfam PF02219
  6. 2089958Protein automated matches [193645] (3 species)
    not a true protein
  7. 2286894Species Haemophilus influenzae [TaxId:71421] [330195] (1 PDB entry)
  8. 2286911Domain d5umec_: 5ume C: [330212]
    Other proteins in same PDB: d5umee2
    automated match to d3fste_
    complexed with acy, edo, fad, fmt, so4

Details for d5umec_

PDB Entry: 5ume (more details), 2.7 Å

PDB Description: crystal structure of 5,10-methylenetetrahydrofolate reductase metf from haemophilus influenzae
PDB Compounds: (C:) 5,10-Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d5umec_:

Sequence, based on SEQRES records: (download)

>d5umec_ c.1.23.1 (C:) automated matches {Haemophilus influenzae [TaxId: 71421]}
akeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansg
erdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepkgy
akkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqff
fdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldnd
pttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp

Sequence, based on observed residues (ATOM records): (download)

>d5umec_ c.1.23.1 (C:) automated matches {Haemophilus influenzae [TaxId: 71421]}
akeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansg
erdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepakk
pfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqfffdi
enylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldndptt
rnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp

SCOPe Domain Coordinates for d5umec_:

Click to download the PDB-style file with coordinates for d5umec_.
(The format of our PDB-style files is described here.)

Timeline for d5umec_:

  • d5umec_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23