SCOP 1.57: Domain d1gnwa2: 1gnw A:2-85

Lineage for d1gnwa2 (1gnw A:2-85)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)

8. Domain d1gnwa2: 1gnw A:2-85 [33021]
   Other proteins in same PDB: d1gnwa1, d1gnwb1

Details for d1gnwa2

PDB Entry: 1gnw, 2.2 Å

PDB Description: structure of glutathione s-transferase

SCOP Domain Sequences for d1gnwa2:

Sequence; same for both SEQRES and ATOM records:

>d1gnwa2 c.47.1.5 (A:2-85) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

Timeline for d1gnwa2:

• d1gnwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1gnwa2 appears in SCOP 1.59
  
• d1gnwa2 appears in the current release, SCOPe 2.08