SCOPe 2.03: Domain d1fhea2: 1fhe A:1-80

Lineage for d1fhea2 (1fhe A:1-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)

8. Domain d1fhea2: 1fhe A:1-80 [33020]
   Other proteins in same PDB: d1fhea1
   complexed with gsh

Details for d1fhea2

PDB Entry: 1fhe, 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1fhea2:

Sequence; same for both SEQRES and ATOM records:

>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
kckltqsvaimryiadkhgm

Timeline for d1fhea2:

• d1fhea2 first appeared (with stable ids) in SCOP 1.55, called d1fhe_2
  
• d1fhea2 appears in SCOPe 2.02
  
• d1fhea2 appears in SCOPe 2.04
  
• d1fhea2 appears in the current release, SCOPe 2.08