Lineage for d2fheb2 (2fhe B:1-80)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584732Protein Class alpha GST [81360] (8 species)
  7. 584738Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)
  8. 584740Domain d2fheb2: 2fhe B:1-80 [33019]
    Other proteins in same PDB: d2fhea1, d2fheb1

Details for d2fheb2

PDB Entry: 2fhe (more details), 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fheb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fheb2 c.47.1.5 (B:1-80) Class alpha GST {Fasciola hepatica}
paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
kckltqslailryiadkhgm

SCOP Domain Coordinates for d2fheb2:

Click to download the PDB-style file with coordinates for d2fheb2.
(The format of our PDB-style files is described here.)

Timeline for d2fheb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fheb1