Lineage for d2fheb2 (2fhe B:1-80)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181026Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)
  8. 181028Domain d2fheb2: 2fhe B:1-80 [33019]
    Other proteins in same PDB: d2fhea1, d2fheb1

Details for d2fheb2

PDB Entry: 2fhe (more details), 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fheb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fheb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Fasciola hepatica}
paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
kckltqslailryiadkhgm

SCOP Domain Coordinates for d2fheb2:

Click to download the PDB-style file with coordinates for d2fheb2.
(The format of our PDB-style files is described here.)

Timeline for d2fheb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fheb1