Lineage for d5tp3a_ (5tp3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (134 PDB entries)
  8. 2286881Domain d5tp3a_: 5tp3 A: [330182]
    automated match to d4grwe_

Details for d5tp3a_

PDB Entry: 5tp3 (more details), 1.87 Å

PDB Description: crystal structure of the rsv-neutralizing single-domain antibody f- vhh-4
PDB Compounds: (A:) f-vhh-4

SCOPe Domain Sequences for d5tp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tp3a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftldyyyigwfrqapgkereavscisgssgstyy
pdsvkgrftisrdnakntvylqmnslkpedtavyycatirssswggcvhygmdywgkgtq
vtvss

SCOPe Domain Coordinates for d5tp3a_:

Click to download the PDB-style file with coordinates for d5tp3a_.
(The format of our PDB-style files is described here.)

Timeline for d5tp3a_:

  • d5tp3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from other chains:
(mouse over for more information)
d5tp3b_