Lineage for d5m7ec1 (5m7e C:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (43 PDB entries)
  8. 2286879Domain d5m7ec1: 5m7e C:1-245 [330180]
    Other proteins in same PDB: d5m7ea2, d5m7eb2, d5m7ec2, d5m7ed2, d5m7ee_, d5m7ef1, d5m7ef2, d5m7ef3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5

Details for d5m7ec1

PDB Entry: 5m7e (more details), 2.05 Å

PDB Description: tubulin-bkm120 complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5m7ec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7ec1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5m7ec1:

Click to download the PDB-style file with coordinates for d5m7ec1.
(The format of our PDB-style files is described here.)

Timeline for d5m7ec1:

  • d5m7ec1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23