SCOPe 2.04: Domain d2fhea2: 2fhe A:1-80

Lineage for d2fhea2 (2fhe A:1-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)

8. Domain d2fhea2: 2fhe A:1-80 [33018]
   Other proteins in same PDB: d2fhea1, d2fheb1
   complexed with gsh

Details for d2fhea2

PDB Entry: 2fhe, 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2fhea2:

Sequence; same for both SEQRES and ATOM records:

>d2fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
kckltqslailryiadkhgm

Timeline for d2fhea2:

• d2fhea2 first appeared (with stable ids) in SCOP 1.55
  
• d2fhea2 appears in SCOPe 2.03
  
• d2fhea2 appears in SCOPe 2.05
  
• d2fhea2 appears in the current release, SCOPe 2.08