Lineage for d5tzza1 (5tzz A:579-917)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2019338Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2019339Protein automated matches [190983] (9 species)
    not a true protein
  7. 2019353Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2019423Domain d5tzza1: 5tzz A:579-917 [330176]
    Other proteins in same PDB: d5tzza2, d5tzzb2
    automated match to d4d09a_
    complexed with 7oj, mg, zn

Details for d5tzza1

PDB Entry: 5tzz (more details), 1.6 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 1-[(3- bromo-4-fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}piperidine
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tzza1 a.211.1.0 (A:579-917) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d5tzza1:

Click to download the PDB-style file with coordinates for d5tzza1.
(The format of our PDB-style files is described here.)

Timeline for d5tzza1: