SCOP 1.59: Domain d1bg5_2: 1bg5 1-80

Lineage for d1bg5_2 (1bg5 1-80)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (5 PDB entries)

8. Domain d1bg5_2: 1bg5 1-80 [33017]
   Other proteins in same PDB: d1bg5_1

Details for d1bg5_2

PDB Entry: 1bg5, 2.6 Å

PDB Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase

SCOP Domain Sequences for d1bg5_2:

Sequence; same for both SEQRES and ATOM records:

>d1bg5_2 c.47.1.5 (1-80) Glutathione S-transferase {Schistosoma japonicum}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d1bg5_2:

• d1bg5_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bg5_2 appears in SCOP 1.57
  
• d1bg5_2 appears in SCOP 1.61
  
• d1bg5_2 appears in the current release, SCOPe 2.08, called d1bg5a2