Lineage for d5m7eb2 (5m7e B:246-438)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (56 PDB entries)
  8. 2525577Domain d5m7eb2: 5m7e B:246-438 [330167]
    Other proteins in same PDB: d5m7ea1, d5m7eb1, d5m7ec1, d5m7ed1, d5m7ee_, d5m7ef1, d5m7ef2, d5m7ef3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5

Details for d5m7eb2

PDB Entry: 5m7e (more details), 2.05 Å

PDB Description: tubulin-bkm120 complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5m7eb2:

Sequence, based on SEQRES records: (download)

>d5m7eb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d5m7eb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
a

SCOPe Domain Coordinates for d5m7eb2:

Click to download the PDB-style file with coordinates for d5m7eb2.
(The format of our PDB-style files is described here.)

Timeline for d5m7eb2: