SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lg8a_ (5lg8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988416Protein (Apo)ferritin [47246] (8 species)
  7. 1988528Species Human (Homo sapiens) [TaxId:9606] [187702] (8 PDB entries)
  8. 2286864Domain d5lg8a_: 5lg8 A: [330165]
    automated match to d2fg8a_
    complexed with cd, fe, oxy, per, so4

Details for d5lg8a_

PDB Entry: 5lg8 (more details), 1.98 Å

PDB Description: human l-type ferritin iron loaded for 60 minutes
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d5lg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lg8a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
sqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekreg
yerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsart
dphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd

SCOPe Domain Coordinates for d5lg8a_:

Click to download the PDB-style file with coordinates for d5lg8a_.
(The format of our PDB-style files is described here.)

Timeline for d5lg8a_:

  • d5lg8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23