Lineage for d1gtb_2 (1gtb 1-80)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) Protein Glutathione S-transferase [52863] (22 species) 
Species Schistosoma japonicum [TaxId:6182] [52878] (5 PDB entries) 
Domain d1gtb_2: 1gtb 1-80 [33016]
Other proteins in same PDB: d1gtb_1
Details for d1gtb_2
PDB Entry: 1gtb (more details), 2.6 Å
PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
SCOP Domain Sequences for d1gtb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtb_2 c.47.1.5 (1-80) Glutathione S-transferase {Schistosoma japonicum}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn
SCOP Domain Coordinates for d1gtb_2:
Click to download the PDB-style file with coordinates for d1gtb_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtb_2:
- d1gtb_2 appears in SCOP 1.57
- d1gtb_2 appears in the current release, SCOPe 2.08, called d1gtba2
View in 3D
