SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m9mb_ (5m9m B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155703Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2155704Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2155705Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)
  6. 2155731Protein Angiogenin [54094] (2 species)
  7. 2155735Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. 2286857Domain d5m9mb_: 5m9m B: [330158]
    automated match to d1a4yb_
    complexed with btb, edo, pge, so4

Details for d5m9mb_

PDB Entry: 5m9m (more details), 1.65 Å

PDB Description: human angiogenin pd variant q77p
PDB Compounds: (B:) angiogenin

SCOPe Domain Sequences for d5m9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m9mb_ d.5.1.1 (B:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
qdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfpvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
r

SCOPe Domain Coordinates for d5m9mb_:

Click to download the PDB-style file with coordinates for d5m9mb_.
(The format of our PDB-style files is described here.)

Timeline for d5m9mb_:

  • d5m9mb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23