SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tupa2 (5tup A:127-254)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. 2286840Species Aspergillus fumigatus [TaxId:1437362] [330141] (1 PDB entry)
  8. 2286852Domain d5tupa2: 5tup A:127-254 [330153]
    Other proteins in same PDB: d5tupc3
    automated match to d1plqa2

Details for d5tupa2

PDB Entry: 5tup (more details), 2.6 Å

PDB Description: x-ray crystal structure of the aspergillus fumigatus sliding clamp
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5tupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tupa2 d.131.1.0 (A:127-254) automated matches {Aspergillus fumigatus [TaxId: 1437362]}
aipeteyaatvempsaefqricrdlnalsesvvieatkegvkfscqgdigsgsvtirqht
svdkpeqnvsialsepvaltfslkylvnfckatslsskvtlclsqevpllveyglgsghl
rfylapki

SCOPe Domain Coordinates for d5tupa2:

Click to download the PDB-style file with coordinates for d5tupa2.
(The format of our PDB-style files is described here.)

Timeline for d5tupa2:

  • d5tupa2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23