SCOP 1.61: Domain d1gne_2: 1gne 1-79

Lineage for d1gne_2 (1gne 1-79)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (5 PDB entries)

8. Domain d1gne_2: 1gne 1-79 [33015]
   Other proteins in same PDB: d1gne_1

Details for d1gne_2

PDB Entry: 1gne, 2.5 Å

PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1

SCOP Domain Sequences for d1gne_2:

Sequence; same for both SEQRES and ATOM records:

>d1gne_2 c.47.1.5 (1-79) Glutathione S-transferase {Schistosoma japonicum}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

Timeline for d1gne_2:

• d1gne_2 first appeared (with stable ids) in SCOP 1.55
  
• d1gne_2 appears in SCOP 1.59
  
• d1gne_2 appears in SCOP 1.63
  
• d1gne_2 appears in the current release, SCOPe 2.08, called d1gnea2