Lineage for d1gne_2 (1gne 1-79)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24478Species Schistosoma japonicum [TaxId:6182] [52878] (5 PDB entries)
  8. 24482Domain d1gne_2: 1gne 1-79 [33015]
    Other proteins in same PDB: d1gne_1

Details for d1gne_2

PDB Entry: 1gne (more details), 2.5 Å

PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1

SCOP Domain Sequences for d1gne_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gne_2 c.47.1.5 (1-79) Glutathione S-transferase {Schistosoma japonicum}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

SCOP Domain Coordinates for d1gne_2:

Click to download the PDB-style file with coordinates for d1gne_2.
(The format of our PDB-style files is described here.)

Timeline for d1gne_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gne_1