Lineage for d5tuza_ (5tuz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (2 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)
  8. 2286846Domain d5tuza_: 5tuz A: [330147]
    automated match to d3mo5c_
    complexed with 7l6, edo, sam, zn

Details for d5tuza_

PDB Entry: 5tuz (more details), 1.95 Å

PDB Description: structure of human glp set-domain (ehmt1) in complex with inhibitor ms0124
PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT1

SCOPe Domain Sequences for d5tuza_:

Sequence, based on SEQRES records: (download)

>d5tuza_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevy
cidarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdyger
fwdikgklfscrcgspkcrhs

Sequence, based on observed residues (ATOM records): (download)

>d5tuza_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldngevyci
darfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfw
dikgklfscrcgspkcrhs

SCOPe Domain Coordinates for d5tuza_:

Click to download the PDB-style file with coordinates for d5tuza_.
(The format of our PDB-style files is described here.)

Timeline for d5tuza_:

  • d5tuza_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23