SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ta8a_ (5ta8 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (768 PDB entries)
  8. 2286839Domain d5ta8a_: 5ta8 A: [330140]
    automated match to d2rkua_
    complexed with 79c, zn

Details for d5ta8a_

PDB Entry: 5ta8 (more details), 2.6 Å

PDB Description: crystal structure of plk1 in complex with a novel 5,6- dihydroimidazolo[1,5-f]pteridine inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d5ta8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ta8a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akeipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqre
kmsmeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyy
lrqivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkkvlcgtpn
yiapevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinp
vaasliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsiaps

SCOPe Domain Coordinates for d5ta8a_:

Click to download the PDB-style file with coordinates for d5ta8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ta8a_:

  • d5ta8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23