Lineage for d5tzaa1 (5tza A:579-916)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (8 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2286837Domain d5tzaa1: 5tza A:579-916 [330138]
    Other proteins in same PDB: d5tzaa2, d5tzab2
    automated match to d4d09a_
    complexed with 7og, mg, zn

Details for d5tzaa1

PDB Entry: 5tza (more details), 1.7 Å

PDB Description: crystal structure of human phosphodiesterase 2a with 3-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl-1-[(naphthalene-2-yl) carbonyl]piperidine
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tzaa1 a.211.1.0 (A:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

SCOPe Domain Coordinates for d5tzaa1:

Click to download the PDB-style file with coordinates for d5tzaa1.
(The format of our PDB-style files is described here.)

Timeline for d5tzaa1:

  • d5tzaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23