Lineage for d5luvb1 (5luv B:1-137)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2189245Species Pseudomonas putida [TaxId:160488] [256090] (3 PDB entries)
  8. 2286832Domain d5luvb1: 5luv B:1-137 [330133]
    Other proteins in same PDB: d5luvb2
    automated match to d3sw1a_
    complexed with cl, so4

Details for d5luvb1

PDB Entry: 5luv (more details), 2.5 Å

PDB Description: short lov protein w619_1 in apo-state
PDB Compounds: (B:) Putative PAS/PAC sensor protein

SCOPe Domain Sequences for d5luvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5luvb1 d.110.3.0 (B:1-137) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaeqegddtiliyvnpaferltgysrdeilyqdcrflqgdd
rdqlararirkalaegrpcrevlrnyrkdgsafwnelsitpvkcdadhrtyfigiqkdvs
rqvelerelaemhvrrn

SCOPe Domain Coordinates for d5luvb1:

Click to download the PDB-style file with coordinates for d5luvb1.
(The format of our PDB-style files is described here.)

Timeline for d5luvb1:

  • d5luvb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5luvb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5luva_