SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5luvb1 (5luv B:1-137)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2189245Species Pseudomonas putida [TaxId:160488] [256090] (3 PDB entries)
  8. 2286832Domain d5luvb1: 5luv B:1-137 [330133]
    Other proteins in same PDB: d5luvb2
    automated match to d3sw1a_
    complexed with cl, so4

Details for d5luvb1

PDB Entry: 5luv (more details), 2.5 Å

PDB Description: short lov protein w619_1 in apo-state
PDB Compounds: (B:) Putative PAS/PAC sensor protein

SCOPe Domain Sequences for d5luvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5luvb1 d.110.3.0 (B:1-137) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaeqegddtiliyvnpaferltgysrdeilyqdcrflqgdd
rdqlararirkalaegrpcrevlrnyrkdgsafwnelsitpvkcdadhrtyfigiqkdvs
rqvelerelaemhvrrn

SCOPe Domain Coordinates for d5luvb1:

Click to download the PDB-style file with coordinates for d5luvb1.
(The format of our PDB-style files is described here.)

Timeline for d5luvb1:

  • d5luvb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5luvb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5luva_