SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tzzd_ (5tzz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (8 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (104 PDB entries)
  8. 2286829Domain d5tzzd_: 5tzz D: [330130]
    Other proteins in same PDB: d5tzza2, d5tzzb2
    automated match to d4d09a_
    complexed with 7oj, mg, zn

Details for d5tzzd_

PDB Entry: 5tzz (more details), 1.6 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 1-[(3- bromo-4-fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}piperidine
PDB Compounds: (D:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzzd_:

Sequence, based on SEQRES records: (download)

>d5tzzd_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlar
fclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhr
gtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlm
rdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrk
iaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka
aelyervasnrehwtkvshkftirglpsnnsldfld

Sequence, based on observed residues (ATOM records): (download)

>d5tzzd_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ytkliqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclm
vkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnn
sfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdii
latdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiael
iykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaely
ervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d5tzzd_:

Click to download the PDB-style file with coordinates for d5tzzd_.
(The format of our PDB-style files is described here.)

Timeline for d5tzzd_:

  • d5tzzd_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23